PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 238aa    MW: 26942.9 Da    PI: 5.1591
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240419.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.31.9e-12640136
             NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevike 36
                    lppGfrFhPtdeelv++yLk+k++g+++el ++i+e
  XP_008240419.1  6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPE 40
                    79*************************999.77765 PP

2NAM92.19.2e-294311060128
             NAM  60 fFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     fF +rd+ky++g r+nrat++gyWk+tgkd++v++ +++++g+kktLv+y+grap+g +tdWvmheyrl
  XP_008240419.1  43 FFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTC-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 110
                     9**********************************.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.1361145IPR003441NAC domain
SuperFamilySSF1019416.93E-484145IPR003441NAC domain
PfamPF023659.4E-277110IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE GNFFGPRDRK YPNGFRTNRA  60
TRAGYWKSTG KDRRVTCQNR AIGMKKTLVY YRGRAPQGIR TDWVMHEYRL DDKDSCSDDT  120
SSSSSSSSPC AAIQDSFALC RVFKKNGICS EMEEQQGQYS ASLIQERSSQ GTTGSATNFN  180
DCETMSPDIP MTASSCLEED DKDDSWMQFI TDDPWMHQCS TNPAMPAEEH LSHVPFTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-40214611169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240419.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ9FFI57e-67NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0M3R8601e-118A0A0M3R860_MANES; NAC transcription factors 57
STRINGPOPTR_0015s05450.11e-116(Populus trichocarpa)
STRINGGLYMA09G29760.21e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.12e-96NAC domain containing protein 57